Protein Info for IAI46_05760 in Serratia liquefaciens MT49
Annotation: RidA family protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 70% identical to AMND_PSESP: 2-aminomuconate deaminase (amnD) from Pseudomonas sp.
KEGG orthology group: K15067, 2-aminomuconate deaminase [EC: 3.5.99.5] (inferred from 78% identity to swd:Swoo_1409)MetaCyc: 76% identical to 2-aminomuconate deaminase (Pseudomonas fluorescens KU-7)
2-aminomuconate deaminase. [EC: 3.5.99.5]
Predicted SEED Role
"Bona fide RidA/YjgF/TdcF/RutC subgroup"
MetaCyc Pathways
- 2-amino-3-carboxymuconate semialdehyde degradation to 2-hydroxypentadienoate (4/4 steps found)
- L-tryptophan degradation IX (9/12 steps found)
- L-tryptophan degradation XII (Geobacillus) (9/12 steps found)
- 2-aminophenol degradation (3/4 steps found)
- 2-nitrobenzoate degradation I (5/7 steps found)
- 2-amino-3-carboxymuconate semialdehyde degradation to glutaryl-CoA (3/5 steps found)
- L-tryptophan degradation III (eukaryotic) (8/15 steps found)
- 4-nitrotoluene degradation II (3/9 steps found)
- L-tryptophan degradation XI (mammalian, via kynurenine) (8/23 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 3.5.99.5
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (139 amino acids)
>IAI46_05760 RidA family protein (Serratia liquefaciens MT49) MTNQAVVVKGKAAPRGRFPHVKRAGDFLFVSGTSARLPDNSIAGAEADAMGATRLAIDVQ TRAVLDNIRDILRSVGADLNDVVEISAFLVNMNDFAGYNAVYADYFDYDGPTRTTVAVHQ LPHPHLLIEIKAIAYKPQK