Protein Info for IAI46_05755 in Serratia liquefaciens MT49
Annotation: 3-hydroxyanthranilate 3,4-dioxygenase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 69% identical to 3HAO_CUPNJ: 3-hydroxyanthranilate 3,4-dioxygenase (nbaC) from Cupriavidus necator (strain JMP 134 / LMG 1197)
KEGG orthology group: K00452, 3-hydroxyanthranilate 3,4-dioxygenase [EC: 1.13.11.6] (inferred from 69% identity to reu:Reut_B5502)MetaCyc: 60% identical to 3-hydroxyanthranilate 3,4-dioxygenase subunit (Pseudomonas fluorescens KU-7)
3-hydroxyanthranilate 3,4-dioxygenase. [EC: 1.13.11.6]
Predicted SEED Role
"3-hydroxyanthranilate 3,4-dioxygenase (EC 1.13.11.6)" in subsystem NAD and NADP cofactor biosynthesis global or Quinolinic acid and its derivatives (EC 1.13.11.6)
MetaCyc Pathways
- NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde (4/4 steps found)
- L-tryptophan degradation IX (9/12 steps found)
- L-tryptophan degradation XII (Geobacillus) (9/12 steps found)
- 2-nitrobenzoate degradation I (5/7 steps found)
- superpathway of NAD biosynthesis in eukaryotes (10/14 steps found)
- NAD de novo biosynthesis II (from tryptophan) (6/9 steps found)
- L-tryptophan degradation to 2-amino-3-carboxymuconate semialdehyde (2/5 steps found)
- L-tryptophan degradation III (eukaryotic) (8/15 steps found)
- L-tryptophan degradation XI (mammalian, via kynurenine) (8/23 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 1.13.11.6
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (190 amino acids)
>IAI46_05755 3-hydroxyanthranilate 3,4-dioxygenase (Serratia liquefaciens MT49) MSNFKYGFPLNFNTWLDSNAHRLKPPVNNQQIWQDSDYMVTVVGGPNQRTDFHDNPVEEF FYQFKGNAYLNIWDDGRYDRIDLREGDIFLMAPHVLHSPQRPEEGSLCLVLERMRPENEP DAIQWSCAACGNLIKRYEMNLKSIVADLPPVYEQFYATSDEERRCSQCGEIHPSRDAQTW HRTLKATENR