Protein Info for IAI46_05720 in Serratia liquefaciens MT49

Annotation: DoxX family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 transmembrane" amino acids 15 to 38 (24 residues), see Phobius details amino acids 53 to 76 (24 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details PF07291: MauE" amino acids 20 to 103 (84 residues), 27.6 bits, see alignment E=3.4e-10 PF07681: DoxX" amino acids 23 to 99 (77 residues), 69.3 bits, see alignment E=3.6e-23

Best Hits

Swiss-Prot: 47% identical to YQJF_ECOLI: Inner membrane protein YqjF (yqjF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 53% identity to pao:Pat9b_3502)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (139 amino acids)

>IAI46_05720 DoxX family protein (Serratia liquefaciens MT49)
MSIKGKIDNIIDNKLFFGLVSILMRVLLSSVFIIAGIGKISAYNATAEYMASMGVPAILL
PLVILTELGGGVALLLGFQTRIVAILFFGFCIISGLIFHSGPDLQSQLMLMKNITMSGGF
IALFLLGAGGFSLDNRKNP