Protein Info for IAI46_05600 in Serratia liquefaciens MT49

Annotation: type VI secretion system ATPase TssH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 845 transmembrane" amino acids 373 to 389 (17 residues), see Phobius details TIGR03345: type VI secretion ATPase, ClpV1 family" amino acids 13 to 826 (814 residues), 1062 bits, see alignment E=0 PF02861: Clp_N" amino acids 25 to 74 (50 residues), 20.2 bits, see alignment 2.4e-07 PF00004: AAA" amino acids 215 to 346 (132 residues), 44.5 bits, see alignment E=1e-14 amino acids 583 to 704 (122 residues), 25.6 bits, see alignment E=6.6e-09 PF17871: AAA_lid_9" amino acids 357 to 445 (89 residues), 91.8 bits, see alignment E=1.1e-29 PF07724: AAA_2" amino acids 577 to 741 (165 residues), 188 bits, see alignment E=6.2e-59 PF07728: AAA_5" amino acids 582 to 703 (122 residues), 36.9 bits, see alignment E=1.7e-12 PF10431: ClpB_D2-small" amino acids 750 to 822 (73 residues), 36.7 bits, see alignment E=1.6e-12

Best Hits

KEGG orthology group: K11907, type VI secretion system protein VasG (inferred from 73% identity to rah:Rahaq_4931)

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (845 amino acids)

>IAI46_05600 type VI secretion system ATPase TssH (Serratia liquefaciens MT49)
MGSYLKNIVANLDVDARKCLDAAISMAVKRTHHEVETEHLLVALMISHTGLIEKLGLNVG
LRGDDLLDALTASLNTLRSGNSRPPVLSESLVEHLERSWLHASVNWHQKLLPVQAFLGSL
LSDSAGNQIRFSAKVSQALGCDGELADKLLLKECTSPAVHQPMNSGDSNDSALAKYTRNL
TELARQNALDPALGREAEIRQMIDVLLRRRQNNPVLTGEPGVGKTAVVEGLAQRIVEGSV
PETLKNMEILSLDMGLLQAGASVKGEFENRLQTLLREVKAYPSPVILFIDEAHALIGAGG
QAGQNDAANLLKPALARGEIRVLAATTWAEYKKYFEKDAALARRFQVIKIAEPDVGAAIA
MLRSMKSAMSLHHGVTILESALFAAVTLSCRYISGRQLPDKSISLLDTACARVAVSQCHE
PKEIEDLNALLSNIAVERDSLHQEGGNDVRLQWLAQREAEIQQDLGILIPEWLRQRDLVA
SIQASQDIQEMAALRAELSQLHQERPLVFDCVDEACVADVIAGWTGIPLGRMMEKDQSQL
SELLTRLEARVIGQSYALDALVQQVRIGRANLNDPVKPLGVFMLAGPSGVGKTETALALS
DLLYGGEQNLITINMSEYQEAHSVSGLKGSPPGYVGYGQGGVLTEAVRRRPYSVVLLDEV
EKAHPDVMELFYQVFDKGVMEDAEGQLINFRNTLIILTSNMASDRIMSACNAGEINHDDL
VEAIRPEFDRHFRPAFMGRLRLIPYLPVAEKTLTSIIQLKLNKICERFCSVAGYESRLTY
SDKVVKLLASRCRVEQSGAREIDSVLNRELLPLLTDLLLSTEEEKVMILSLNASKDKLTI
SKKRS