Protein Info for IAI46_05445 in Serratia liquefaciens MT49

Annotation: adenosine deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 TIGR01430: adenosine deaminase" amino acids 18 to 334 (317 residues), 257.9 bits, see alignment E=6.1e-81 PF00962: A_deaminase" amino acids 19 to 338 (320 residues), 235.7 bits, see alignment E=7.7e-74 PF19326: AMP_deaminase" amino acids 203 to 332 (130 residues), 38.8 bits, see alignment E=4.2e-14

Best Hits

KEGG orthology group: K01488, adenosine deaminase [EC: 3.5.4.4] (inferred from 41% identity to bts:Btus_2009)

Predicted SEED Role

"Adenosine deaminase (EC 3.5.4.4)" in subsystem Purine conversions (EC 3.5.4.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.4

Use Curated BLAST to search for 3.5.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (351 amino acids)

>IAI46_05445 adenosine deaminase (Serratia liquefaciens MT49)
MEWNVNQTRFSRAQMVSLPKAEVHVHLEGCFDPEQLAVWALSSRISISRKQDALLNFNGL
ADFLAFLDWCCGLVSSRERLAQLSYSYAQRLSQNGGLYADLIFNPTHWKAWRGRLGEMID
AIDAGLRAAEEDGLASVGLCVSLLRQQTAAEASELVDFLTALRHPRVVALSIDGNEAVTK
GSGARFAQAFARTGRAGLKRTVHAGEFSGAEGVRDAILLLGADRIDHGVRAIDDPAVVAL
LAERQIPIGVCLTSNIKLGVYPRYAEHPLRRLRDAGVITTINTDDPELLQTTLVDEYLVC
QNEFEFSPHDIVDVARNSLAASFASDEAKMTYRKKMDSWVASLNTENGDKR