Protein Info for IAI46_05375 in Serratia liquefaciens MT49

Annotation: 5-(carboxyamino)imidazole ribonucleotide mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00731: AIRC
  • amino acids 14 to 162 (149 residues), 213.9 bits, E=3.7e-68
• TIGR01162: phosphoribosylaminoimidazole carboxylase, catalytic subunit
  • amino acids 15 to 169 (155 residues), 218.2 bits, E=1.9e-69

Best Hits

Swiss-Prot: 83% identical to PURE_ECOLI: N5-carboxyaminoimidazole ribonucleotide mutase (purE) from Escherichia coli (strain K12)

KEGG orthology group: K01588, 5-(carboxyamino)imidazole ribonucleotide mutase [EC: 5.4.99.18] (inferred from 94% identity to srs:SerAS12_1092)

MetaCyc: 83% identical to N5-carboxyaminoimidazole ribonucleotide mutase (Escherichia coli K-12 substr. MG1655)
5-(carboxyamino)imidazole ribonucleotide mutase. [EC: 5.4.99.18]

Predicted SEED Role

"Phosphoribosylaminoimidazole carboxylase catalytic subunit (EC 4.1.1.21)" in subsystem De Novo Purine Biosynthesis (EC 4.1.1.21)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (26/26 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• inosine-5'-phosphate biosynthesis I (6/6 steps found)
• inosine-5'-phosphate biosynthesis II (5/5 steps found)
• inosine-5'-phosphate biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.21

Use Curated BLAST to search for 4.1.1.21 or 5.4.99.18

Protein Sequence (174 amino acids)

>IAI46_05375 5-(carboxyamino)imidazole ribonucleotide mutase (Serratia liquefaciens MT49)
MGANAASATHAEVKIAIVMGSKSDWATMQFAAEVLTSLDVPFHVEVVSAHRTPDKLFSFA
EQASAKGIDVIIAGAGGAAHLPGMLAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIP
VGTLAIGKAGAANAALLAAQILALHDAELAQRLADWRQAQTDEVLNNPDPREEA