Protein Info for IAI46_05360 in Serratia liquefaciens MT49

Annotation: sugar porter family MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 transmembrane" amino acids 21 to 48 (28 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 147 to 165 (19 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 256 to 279 (24 residues), see Phobius details amino acids 295 to 316 (22 residues), see Phobius details amino acids 325 to 346 (22 residues), see Phobius details amino acids 354 to 378 (25 residues), see Phobius details amino acids 391 to 416 (26 residues), see Phobius details amino acids 423 to 441 (19 residues), see Phobius details TIGR00879: MFS transporter, sugar porter (SP) family" amino acids 4 to 452 (449 residues), 483.9 bits, see alignment E=2.7e-149 PF00083: Sugar_tr" amino acids 23 to 455 (433 residues), 472.5 bits, see alignment E=2.9e-145 PF07690: MFS_1" amino acids 28 to 291 (264 residues), 114.5 bits, see alignment E=1.1e-36 amino acids 263 to 445 (183 residues), 35.2 bits, see alignment E=1.4e-12 PF06609: TRI12" amino acids 40 to 207 (168 residues), 36.4 bits, see alignment E=4.6e-13 PF13347: MFS_2" amino acids 246 to 380 (135 residues), 27.1 bits, see alignment E=3e-10

Best Hits

Swiss-Prot: 83% identical to GALP_ECOL6: Galactose-proton symporter (galP) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K08137, MFS transporter, SP family, galactose:H+ symporter (inferred from 97% identity to spe:Spro_1160)

MetaCyc: 83% identical to galactose:H+ symporter (Escherichia coli K-12 substr. MG1655)
RXN0-7077; TRANS-RXN-21

Predicted SEED Role

"Arabinose-proton symporter" in subsystem L-Arabinose utilization

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (468 amino acids)

>IAI46_05360 sugar porter family MFS transporter (Serratia liquefaciens MT49)
MSTTVKVSAAEKSQSNAGMTFFVCFLAALAGLLFGLDIGVIAGALPFITDSFNITSSQQE
WVVSSMMFGAAVGAVGSGWMNFRIGRKYSLMIGAVLFVVGSLCSAAAPNVEILLISRVLL
GLAVGVASYTAPIYLSEIAPEKIRGSMISMYQLMITIGILAAYLSDTAFSYTGAWRWMLG
VITIPAVLLLIGVFFLPDSPRWLASRNRHEQARQVLEKLRDTSAQAQHELNEIRESLKLK
QSGWALFKDNKNFRRAVFLGVLLQVMQQFTGMNVIMYYAPKIFGLAGFASTAQQMWGTVI
VGLVNVLATFIAIGLVDRWGRKPTLTLGFVVMAVGMGALGTMMNVGMTSPAEQYFAIIML
LMFIVGFAMSAGPLIWVLCSEIQPLKGRDFGITCSTATNWIANMIVGATFLTMLNSLGSA
HTFWVYAALNLVFIFITLALIPETKNISLEHIERNLMAGKPLRNIGSR