Protein Info for IAI46_05340 in Serratia liquefaciens MT49

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 3 to 191 (189 residues), 150.5 bits, E=8.2e-48
• PF08659: KR
  • amino acids 5 to 174 (170 residues), 46.7 bits, E=6.9e-16
• PF01370: Epimerase
  • amino acids 5 to 66 (62 residues), 20.9 bits, E=4.2e-08
• PF13561: adh_short_C2
  • amino acids 11 to 191 (181 residues), 102.9 bits, E=4.2e-33

Best Hits

Swiss-Prot: 68% identical to YBBO_ECOL6: Uncharacterized oxidoreductase YbbO (ybbO) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 98% identity to spe:Spro_1156)

MetaCyc: 68% identical to NADP+-dependent aldehyde reductase YbbO (Escherichia coli K-12 substr. MG1655)
Alcohol dehydrogenase (NADP(+)). [EC: 1.1.1.2]; 1.1.1.- [EC: 1.1.1.2]

Predicted SEED Role

"Putative NAD(P)-dependent oxidoreductase EC-YbbO"

MetaCyc Pathways

• glycerol degradation to butanol (11/16 steps found)
• L-tryptophan degradation X (mammalian, via tryptamine) (2/4 steps found)
• pyruvate fermentation to butanol I (4/8 steps found)
• D-xylose degradation to ethylene glycol (engineered) (1/4 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (6/13 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (8/17 steps found)
• detoxification of reactive carbonyls in chloroplasts (1/10 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Caprolactam degradation
• Carotenoid biosynthesis - General
• Glycerolipid metabolism
• Glycolysis / Gluconeogenesis
• Insect hormone biosynthesis
• Nucleotide sugars metabolism
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Trinitrotoluene degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.- or 1.1.1.2

Protein Sequence (258 amino acids)

>IAI46_05340 SDR family oxidoreductase (Serratia liquefaciens MT49)
MQKAVLITGCSSGIGLIAAQDLRNRGYRVLAACRKPQDVENMRQLGLEGIELDLDDSDSV
ERAAAQVIELTGNRLYGLFNNGGFGVYGPLSSISRQQLERQFATNLFGTHQLTQLLLPAM
LPHGEGRIIQTSSVMGLVSSAGRGAYAASKFALEAWSDALRMELHGTGIQVSLIEPGPIS
THFTQNVNQAQSDKPVHNPGIAKRLTLPPEAILPKLRHALESPRAKLRYPVTLLAHALSV
LRRILPGRCLDWLLRSNG