Protein Info for IAI46_05330 in Serratia liquefaciens MT49

Annotation: cyclopropane fatty acyl phospholipid synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 PF02353: CMAS" amino acids 108 to 368 (261 residues), 348.2 bits, see alignment E=1.1e-107 PF01728: FtsJ" amino acids 155 to 239 (85 residues), 32.9 bits, see alignment E=2.1e-11 PF13489: Methyltransf_23" amino acids 165 to 289 (125 residues), 57.4 bits, see alignment E=5.5e-19 PF13847: Methyltransf_31" amino acids 166 to 270 (105 residues), 42.7 bits, see alignment E=1.8e-14 PF08242: Methyltransf_12" amino acids 172 to 263 (92 residues), 43.8 bits, see alignment E=1.2e-14 PF13649: Methyltransf_25" amino acids 172 to 261 (90 residues), 64.4 bits, see alignment E=4.6e-21 PF08241: Methyltransf_11" amino acids 172 to 264 (93 residues), 57.6 bits, see alignment E=5.6e-19

Best Hits

Swiss-Prot: 73% identical to CFA_ECOLI: Cyclopropane-fatty-acyl-phospholipid synthase (cfa) from Escherichia coli (strain K12)

KEGG orthology group: K00574, cyclopropane-fatty-acyl-phospholipid synthase [EC: 2.1.1.79] (inferred from 94% identity to spe:Spro_1154)

MetaCyc: 73% identical to cyclopropane fatty acyl phospholipid synthase (Escherichia coli K-12 substr. MG1655)
Cyclopropane-fatty-acyl-phospholipid synthase. [EC: 2.1.1.79]

Predicted SEED Role

"Cyclopropane-fatty-acyl-phospholipid synthase (EC 2.1.1.79)" (EC 2.1.1.79)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.79

Use Curated BLAST to search for 2.1.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (383 amino acids)

>IAI46_05330 cyclopropane fatty acyl phospholipid synthase (Serratia liquefaciens MT49)
MDSISVDELAPKKDRWYRIVEELLSSADVAINGNRACDIKVHNPALFKRILQEGSLGFGE
SYMDGWWDCERLDVLFTRILQAGVDERLPKNLSDIARIAYARLFNRQSRKRAWQVGKEHY
DIGNDLFRAMLDPYMQYSCGYWKDADTLEQAQQAKLKMICEKLQLKPGMSLLDIGCGWGG
LAQYAAENYGVSVYGVTISAEQQKLAQERCQGLDVEIQLQDYRDLDRQFDRIVSVGMFEH
VGPKNYDTYFRVAARNLKPDGLFLLHTIGANQTNLHVDAWIDKYIFPNGCLPSVRHISEA
SEGRFVMEDWHNIGADYDRTLMAWYENFKRAWPQLAEEYSERFERMFTYYLNACAGAFRA
RDIQLWQVLFSPKGVDGGVRVYR