Protein Info for IAI46_05295 in Serratia liquefaciens MT49

Annotation: isoprenylcysteine carboxylmethyltransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details amino acids 45 to 65 (21 residues), see Phobius details amino acids 85 to 103 (19 residues), see Phobius details amino acids 123 to 146 (24 residues), see Phobius details amino acids 167 to 186 (20 residues), see Phobius details amino acids 192 to 211 (20 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (246 amino acids)

>IAI46_05295 isoprenylcysteine carboxylmethyltransferase family protein (Serratia liquefaciens MT49)
MYRAAVLLYGVVGYFLGLVGFVLLILLLNGWGLRNMVAVREDTDVWPWLVNIVLLLLFGL
VHSVMAHERFKARLALSPALERSSYVLIAGASLALLALVWQPLPGVLWRLPPDSVAAWGL
NGISALGWLVVFASTCMISHTDLFGLRQSWLQWRERQYTDLPFQVRGFYRLTRHPMMTGM
LLAFWFTPEMTAGRLLFNSGMTLYILVGVYFEERSLLKALGADYQRYCRHVPMLLPRMGI
RNKPTE