Protein Info for IAI46_05205 in Serratia liquefaciens MT49

Annotation: mechanosensitive channel MscK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1131 signal peptide" amino acids 1 to 44 (44 residues), see Phobius details transmembrane" amino acids 510 to 530 (21 residues), see Phobius details amino acids 560 to 581 (22 residues), see Phobius details amino acids 593 to 614 (22 residues), see Phobius details amino acids 638 to 654 (17 residues), see Phobius details amino acids 666 to 687 (22 residues), see Phobius details amino acids 699 to 724 (26 residues), see Phobius details amino acids 737 to 758 (22 residues), see Phobius details amino acids 805 to 829 (25 residues), see Phobius details amino acids 848 to 869 (22 residues), see Phobius details amino acids 891 to 915 (25 residues), see Phobius details amino acids 924 to 952 (29 residues), see Phobius details PF12795: MscS_porin" amino acids 58 to 292 (235 residues), 182.2 bits, see alignment E=3.3e-57 PF12794: MscS_TM" amino acids 516 to 836 (321 residues), 321.8 bits, see alignment E=1.2e-99 PF21088: MS_channel_1st" amino acids 897 to 938 (42 residues), 35 bits, see alignment (E = 2.9e-12) PF00924: MS_channel_2nd" amino acids 940 to 1005 (66 residues), 86.2 bits, see alignment 3.3e-28 PF21082: MS_channel_3rd" amino acids 1015 to 1096 (82 residues), 69 bits, see alignment 9.8e-23

Best Hits

KEGG orthology group: K05802, potassium efflux system protein KefA (inferred from 69% identity to dze:Dd1591_3045)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (1131 amino acids)

>IAI46_05205 mechanosensitive channel MscK (Serratia liquefaciens MT49)
MHRRLAKRLFLPLVSLFGVEFSRAFALFLLIAFCAVCQPAAYAALNGDVPSRSEIQSQLD
ALNKQKTLTPVNKLTQQDLTRTLELLDAIDRTRQDGAQLKQQLQLAPGKLRQVTDDLAAL
KTPVDSAAARAELLQLSLRQLETRLYQTLDDLQTAQENLSTYNSQLVSLQTQPERVQSSM
YTASQRLQEIRNQINDQTPGQNSLRDSQLVMLATEQTLLNAQIDLQRKSLEANTTLQDLL
QKQRDYTTGHIDALDHNVQLLQEVVNSKRLTLSEKTAKEAQNPEDATDIQHDQLVSKELD
VNRQLSQRLIAATEESNVLFQQNIRVKNWLDRGLQAERNLKEQIQVLKGSLVLSRILYQQ
QQSLPQGTLVADMGTRIADLRLEQFDINQQRDDLFKGDDYINKLVADSKEKASADVLDAL
NEIVDMRRELLDQLNKQLSNQLAQSISLQINQQQLTSVNSSLRDTLTQQIFWVNSNKPVD
LAWLKALPGAVRDQLAALDFKVDFGKILQGGLNSLVMLIPLLLLIGLLRWRYKLIDTHLQ
KLANDVGQLKRDSQMHTPRAIVLTLLKVLPGSALLLGVGFWCYRAEIGLSDFLWALSQQL
ALFWLIFGFTYRTLAPGGICERHFNFAAELCAHYRRQTVRLGLALLPLIFWSVLGEKAPL
RLVEDVIGQVVVMLTLALLAVLVFPLCRDSWREKGSHAVRLIIVTAIAATPLILLGLMFA
GYFYTTLRLAGRWIDSLYLFFLWNIVYLTAIRGLSVAARRLAYRRAIARRQSLAKEKEGA
EGVEPVEEPPLALDQINQQSLRLTTMVLFIIFASALYGIWSDLVTVISYLDSITLWHYTT
TVAGSSVAQAVTLGNMMVAIAAVIVAYVMTRNLPGLLEVVVLSRLQLRQGTSYAVTTILT
YLITTVGAVTALGSLGVSWDKLQWLAAGLTVGLGFGLQEIFANFVSGLIILFERPIRIGD
TITIGTFSGSVSKIRIRATTITDFDRKEVIIPNKAFVTERLINWSLSDTITRVLIKVGVA
YGSDLDKVKAVLLKAAHDNPRVMSDPEPQVFFLNFGASTLDHELRLYVRELRDRSYTVDE
LNRSIERLCRENDINIAFNQLEVYLHNQQGNEVQEVKRTLSSDKDGSSVGE