Protein Info for IAI46_05045 in Serratia liquefaciens MT49

Annotation: 7-cyano-7-deazaguanine synthase QueC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06508: QueC
  • amino acids 3 to 214 (212 residues), 265.9 bits, E=1.1e-83
• TIGR00364: queuosine biosynthesis protein QueC
  • amino acids 4 to 207 (204 residues), 277.4 bits, E=2.9e-87

Best Hits

Swiss-Prot: 95% identical to QUEC_SERP5: 7-cyano-7-deazaguanine synthase (queC) from Serratia proteamaculans (strain 568)

KEGG orthology group: K06920, queuosine biosynthesis protein QueC (inferred from 95% identity to spe:Spro_1102)

MetaCyc: 81% identical to 7-cyano-7-deazaguanine synthase (Escherichia coli K-12 substr. MG1655)
RXN-12093 [EC: 6.3.4.20]

Predicted SEED Role

"Queuosine Biosynthesis QueC ATPase" in subsystem Queuosine-Archaeosine Biosynthesis

MetaCyc Pathways

• preQ₀ biosynthesis (3/4 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.20

Protein Sequence (232 amino acids)

>IAI46_05045 7-cyano-7-deazaguanine synthase QueC (Serratia liquefaciens MT49)
MKRAVVVFSGGQDSTTCLIQALQQYDEVHCVTFDYGQRHRAEIEVAQALSVALGAKAHKL
LDVGLLNELAISSLTRDNIPVPAYGSTEANGLPSTFVPGRNILFLTLAAIYAYQVEAEAV
ITGVCETDFSGYPDCRDEFVKALNQAIVLGIARDIRFETPLMWLNKAETWALADYYHQLD
LVRQETLTCYSGIKGDGCGECAACHLRANGLKQYQINKAEVMASLKQKTGLV