Protein Info for IAI46_04990 in Serratia liquefaciens MT49

Annotation: muropeptide MFS transporter AmpG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 492 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 47 to 68 (22 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 177 to 195 (19 residues), see Phobius details amino acids 225 to 250 (26 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details amino acids 290 to 310 (21 residues), see Phobius details amino acids 321 to 342 (22 residues), see Phobius details amino acids 354 to 376 (23 residues), see Phobius details amino acids 382 to 402 (21 residues), see Phobius details amino acids 427 to 448 (22 residues), see Phobius details amino acids 463 to 486 (24 residues), see Phobius details PF13000: Acatn" amino acids 16 to 101 (86 residues), 37.8 bits, see alignment E=9.5e-14 PF07690: MFS_1" amino acids 17 to 366 (350 residues), 117.6 bits, see alignment E=5.9e-38 TIGR00901: AmpG-like permease" amino acids 25 to 363 (339 residues), 396.4 bits, see alignment E=6.9e-123

Best Hits

Swiss-Prot: 75% identical to AMPG_ECOLI: Anhydromuropeptide permease (ampG) from Escherichia coli (strain K12)

KEGG orthology group: K08218, MFS transporter, PAT family, beta-lactamase induction signal transducer AmpG (inferred from 97% identity to spe:Spro_1091)

MetaCyc: 75% identical to muropeptide:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-226; TRANS-RXN0-258

Predicted SEED Role

"AmpG permease"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (492 amino acids)

>IAI46_04990 muropeptide MFS transporter AmpG (Serratia liquefaciens MT49)
MSKQYLNIFTQRNSAILLLLGFASGLPLALTSGTLQAWMTVENIDLKTIGIFSLVGQAYV
FKFLWSPFMDRYTPPFLGRRRGWLLISQLLLVVSIVAMGFMQPAQHLWWLAALAVLVAFC
SASQDIVFDAYKTDLLSAEERGTGAAVSVLGYRLAMLVSGGLALWLADRYLGWQSTYWLM
AGLMLIGIVATLLAPEPDDSIPAPRTMEQAVVAPLRDFFARNNAWLILLLIVMYKMGDAF
AGSLSTTFLIRGVGFDAGEVGLVNKTLGLFATIVGALFGGVLMQRLSLFRALMLFGILQA
VSNLGYWILAVTDKNIMTMGSAIFLENLCGGMGTAAFVALLMTLCNKSFSATQFALLSAL
SAVGRVYVGPIAGWFVEAHGWPLFYLFSIVAAVPGLLLLHLCRQTLEYTQRTDNFMPRTE
FRQFYRWALRLLTVGCSMLGLWLLLLITNALDWTLLPNLADRLLQMGAALSLVGIAMGSL
LDYLALRRTRLA