Protein Info for IAI46_04970 in Serratia liquefaciens MT49

Annotation: cytochrome o ubiquinol oxidase subunit IV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02847: cytochrome o ubiquinol oxidase subunit IV
  • amino acids 15 to 110 (96 residues), 130.6 bits, E=1.2e-42
• PF03626: COX4_pro
  • amino acids 22 to 95 (74 residues), 65.5 bits, E=2.3e-22

Best Hits

Swiss-Prot: 67% identical to CYOD_ECO57: Cytochrome bo(3) ubiquinol oxidase subunit 4 (cyoD) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 98% identity to srr:SerAS9_1000)

MetaCyc: 67% identical to cytochrome bo3 subunit 4 (Escherichia coli K-12 substr. MG1655)
RXN-21817 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit IV (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

• D-lactate to cytochrome bo oxidase electron transfer (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer II (1/2 steps found)
• glycerol-3-phosphate to cytochrome bo oxidase electron transfer (1/2 steps found)
• proline to cytochrome bo oxidase electron transfer (1/2 steps found)
• pyruvate to cytochrome bo oxidase electron transfer (1/2 steps found)
• succinate to cytochrome bo oxidase electron transfer (1/2 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Protein Sequence (112 amino acids)

>IAI46_04970 cytochrome o ubiquinol oxidase subunit IV (Serratia liquefaciens MT49)
MSHSSHETSHGGASHGSVKTYLIGFILSIILTVIPFAMVMSGTASHSTILAVVVGMAVIQ
VVVHLIYFLHMNTSSEERWNLVALLFTAMIIGIVVVGSLWIMYNLNINMMVS