Protein Info for IAI46_04810 in Serratia liquefaciens MT49

Annotation: mechanosensitive ion channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 transmembrane" amino acids 20 to 47 (28 residues), see Phobius details amino acids 69 to 91 (23 residues), see Phobius details amino acids 97 to 122 (26 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 166 to 184 (19 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 185 to 253 (69 residues), 60.1 bits, see alignment E=1.9e-20 PF21082: MS_channel_3rd" amino acids 332 to 396 (65 residues), 30.8 bits, see alignment E=3.3e-11

Best Hits

Swiss-Prot: 63% identical to YBDG_ECOLI: Miniconductance mechanosensitive channel YbdG (ybdG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 96% identity to spe:Spro_1048)

Predicted SEED Role

"Small-conductance mechanosensitive channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (421 amino acids)

>IAI46_04810 mechanosensitive ion channel (Serratia liquefaciens MT49)
MQQQITLWLEKFGLEFSGVMSLLMVLGLIVLISVVIHLVLHRVVLAAIQRRGQRSQRVWQ
QAITQYKLFQRMALLLQGVIINLQAVLWLHAGSETQAIIVTAAQVWIMGFALLSLFSLLD
TLLAMLRQSPISNQLPLRGIFQGLKLVAAILIGIMIVSLLMGKSPLLLLSGLGAMTAVLM
LVFKDPILGLVAGIQLSANDMLSIGDWLEMPKYGADGAVTDIGLTTVKVRNWDNTVTTIP
TYALISDSFKNWRSMSESGGRRIKRSINIDTTSVHFLSEEEQQRLNRNPLLQRYLNDKTQ
ELSQHNQQTGVDLSSPLNGRRLTNLGTLRAYLVAYLRAHPGIHQNMTLMVRQLAPLPEGL
PLEIYAFTNTTVWAEYESIQSDIFDHILAVINEFDLRVHQTPTGNDMRSMLNPLRQAADI
S