Protein Info for IAI46_04800 in Serratia liquefaciens MT49

Annotation: proline-specific permease ProY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 transmembrane" amino acids 23 to 40 (18 residues), see Phobius details amino acids 47 to 69 (23 residues), see Phobius details amino acids 100 to 124 (25 residues), see Phobius details amino acids 131 to 149 (19 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 203 to 226 (24 residues), see Phobius details amino acids 247 to 267 (21 residues), see Phobius details amino acids 284 to 305 (22 residues), see Phobius details amino acids 337 to 357 (21 residues), see Phobius details amino acids 363 to 387 (25 residues), see Phobius details amino acids 407 to 428 (22 residues), see Phobius details amino acids 434 to 452 (19 residues), see Phobius details PF03845: Spore_permease" amino acids 18 to 287 (270 residues), 26.2 bits, see alignment E=5.4e-10 PF00324: AA_permease" amino acids 22 to 458 (437 residues), 391.5 bits, see alignment E=8.1e-121 PF13520: AA_permease_2" amino acids 23 to 445 (423 residues), 128.6 bits, see alignment E=4.7e-41

Best Hits

Swiss-Prot: 85% identical to PROY_SALTY: Proline-specific permease ProY (proY) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 98% identity to srr:SerAS9_0971)

MetaCyc: 48% identical to threonine/serine:H+ symporter ThrP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-71; TRANS-RXN-72

Predicted SEED Role

"Proline-specific permease proY" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (468 amino acids)

>IAI46_04800 proline-specific permease ProY (Serratia liquefaciens MT49)
MQQQSPTAPTPNKLKRGLSTRHIRFMALGSAIGTGLFYGSADAIKMAGPSVLLAYLIGGI
VAFIIMRALGEMSVNNPQASSFSRYAQDYLGPMAGYITGWTYCFEILIVAIADVTAFGIY
MGVWFPEVPHWIWVLSVVLVIGAINLMSVKVFGELEFWFSFFKVATIIIMIAAGIGIIIW
GIGNGGQPTGIHNLWSNGGFFSNGFIGMILSLQLVMFAYGGIEIIGITAGEAKDPKTSIP
KAINSVPWRILVFYVGTLFVIMSIYPWNQVGTNGSPFVLTFQHMGITVAAGILNFVVITA
SLSAINSDVFGVGRMLHGMAEQGHAPKMFSKVSKRGIPWVTVVVMMLALLLAVYLNYIMP
ENVFLVIASLATFATVWVWIMILFSQIAFRRSLSKEQVKGLAFPLRGGVFTSVVAIIFLV
FIIGLIGYFPTTRVSLYAGLVWVAVLLAGYYFKVNRQKKLATLAQQQD