Protein Info for IAI46_04785 in Serratia liquefaciens MT49

Annotation: phosphate ABC transporter substrate-binding protein PstS family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02136: phosphate binding protein
  • amino acids 17 to 297 (281 residues), 235.5 bits, E=3.9e-74
• PF12849: PBP_like_2
  • amino acids 29 to 283 (255 residues), 115.2 bits, E=4.7e-37

Best Hits

Swiss-Prot: 62% identical to PSTS_PSEAI: Phosphate-binding protein PstS (pstS) from Pseudomonas aeruginosa

KEGG orthology group: K02040, phosphate transport system substrate-binding protein (inferred from 97% identity to spe:Spro_1043)

Predicted SEED Role

"Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Protein Sequence (312 amino acids)

>IAI46_04785 phosphate ABC transporter substrate-binding protein PstS family protein (Serratia liquefaciens MT49)
MIRITRGLLLCLALLASRGALAQPDGMLSGNLSSVGSDTLANLMALWAQDFSQHYPNVNL
QIQAAGSSTAPTALAAGAAQLGPMSRPMKAAEVSAFEHRYGYAPLAVPVAVDALVVLVHQ
DNPLRGLNLQQLDRIFSATLRCGESQPLTRWGELGLTGDWQQRALQRFGRNSASGTYGYF
KLRALCGGDFMPRVNELPGSASVVQAVAGSLNSIGYASIGFRASGVRLLPLAETGQNYVT
PNDANVRNGSYPLSRYLYIYINKAPNQPLEPLTAAFLDRVLSDTGQNLVNHDGYLPLPPQ
TLQKTRLALGLQ