Protein Info for IAI46_04750 in Serratia liquefaciens MT49

Annotation: response regulator transcription factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 PF00072: Response_reg" amino acids 5 to 114 (110 residues), 91.3 bits, see alignment E=4.7e-30 PF00486: Trans_reg_C" amino acids 160 to 235 (76 residues), 78.8 bits, see alignment E=2.6e-26

Best Hits

KEGG orthology group: None (inferred from 95% identity to srr:SerAS9_0957)

Predicted SEED Role

"Response regulator protein Z5684"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (246 amino acids)

>IAI46_04750 response regulator transcription factor (Serratia liquefaciens MT49)
MKPAILIVDDDPAICDLLCDVLNEHVFTVHACHRGSEALTLLSQQPDIALVLLDLILPDT
NGLLVLQQIHRLRPDLPVVMLTGLGAESDVVVGLEMGADDYIAKPFNPRVVVARAKAVLR
RTGALALEPAAVGQTRAEGWQFNGWCLDTNRCTLHNPQRQAVDLTQGEYGLLLALVQHAR
KVLTRDRLLELTHGETLEVFDRTIDVLIMRLRRKIEINPHQPELIRTIRGLGYVFAADVS
QPVAAA