Protein Info for IAI46_04735 in Serratia liquefaciens MT49

Annotation: D-lyxose/D-mannose family sugar isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 PF07385: Lyx_isomer" amino acids 1 to 223 (223 residues), 328.2 bits, see alignment E=1.1e-102

Best Hits

KEGG orthology group: K09988, hypothetical protein (inferred from 92% identity to srs:SerAS12_0954)

Predicted SEED Role

"ATP synthase delta chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>IAI46_04735 D-lyxose/D-mannose family sugar isomerase (Serratia liquefaciens MT49)
MNRSAVNQILQQTQHFFARFDVHLPPFAHFSPTVWRQLDRQPWQEVFDLKLGWDVTAFGG
EDFAHKGLTLFTLRNGSPGGQPYAKCYAEKIMHCREAQVTPMHFHWRKREDIINRGGGNL
IVELHNADPQEGLADSPVSVTLDGCRQTHAAGSRLRLAPGESICLTPGIYHSFWGEEGFG
DVLVGEVSTVNDDDNDNRFLTPLSRFSQIEEDQPPQWLLCNEYLRFID