Protein Info for IAI46_04725 in Serratia liquefaciens MT49

Annotation: ribose ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 transmembrane" amino acids 27 to 48 (22 residues), see Phobius details amino acids 60 to 79 (20 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 108 to 139 (32 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details amino acids 218 to 240 (23 residues), see Phobius details amino acids 260 to 289 (30 residues), see Phobius details amino acids 300 to 319 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 52 to 317 (266 residues), 136.6 bits, see alignment E=4.5e-44

Best Hits

Swiss-Prot: 43% identical to RBSC_BACSU: Ribose import permease protein RbsC (rbsC) from Bacillus subtilis (strain 168)

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 98% identity to spe:Spro_1030)

MetaCyc: 32% identical to arabinose ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-2-RXN [EC: 7.5.2.12, 7.5.2.13]

Predicted SEED Role

"ABC transport system, permease protein Z5690"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.12 or 7.5.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (329 amino acids)

>IAI46_04725 ribose ABC transporter permease (Serratia liquefaciens MT49)
MTSNPLPPGAKNPTLKRALLGDMMQTVGILPILILIVAVFGFVAPNFFTDANLLNIARQA
SINIVLAAGMTFIILTGGIDLSVGSMLGTTAVVAMAVSLMPGMAGMSIPLALLAGLGMGL
FNGFLVAYAGLPPFIVTLGTYTALRGAAYLLADGTTIINSNISFEWIGNAYLGPIPWLVI
IAFAVIAVCWFILRRTTLGVHIYAVGGNMQAARLTGIKVGAVLLFVYGMSGLLSGLGGVM
SASRLYSANGNLGMGYELDAIAAVILGGTSFVGGIGTITGTLVGALIIATLNNGMTLMGV
SYFWQLVIKGAVIIIAVLIDKYRTRNYQH