Protein Info for IAI46_04715 in Serratia liquefaciens MT49

Annotation: PAS-domain containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 870 transmembrane" amino acids 14 to 37 (24 residues), see Phobius details amino acids 289 to 312 (24 residues), see Phobius details PF00672: HAMP" amino acids 312 to 360 (49 residues), 36.3 bits, see alignment 1.7e-12 PF12860: PAS_7" amino acids 385 to 488 (104 residues), 45.1 bits, see alignment E=3.1e-15 PF08448: PAS_4" amino acids 385 to 485 (101 residues), 26.1 bits, see alignment E=2.5e-09 PF00512: HisKA" amino acids 501 to 563 (63 residues), 32.8 bits, see alignment 1.8e-11 PF02518: HATPase_c" amino acids 606 to 722 (117 residues), 75.5 bits, see alignment E=1.3e-24 PF00072: Response_reg" amino acids 745 to 854 (110 residues), 38.5 bits, see alignment E=3.4e-13

Best Hits

KEGG orthology group: None (inferred from 94% identity to spe:Spro_1028)

Predicted SEED Role

"Two-component system sensor protein Z5692"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (870 amino acids)

>IAI46_04715 PAS-domain containing protein (Serratia liquefaciens MT49)
MRRLPFLAGARGRLLMFNLLVVAVTLMVSGVAIFGFYHAGKLQEQMQAQTLAEMNGSMAL
SRDTSNVATAAIRLSQVVGALEYQSESARLKQTQLVLQTSLSRLADAPLAHSEPALVKRI
ISRSNALESSVTRMLDLGHQRHLQRNILLSGLYQSQSTLRHIATLNQRNNLNQPSQPLLS
QIDRLLAIAIQTPTPKAAAQQLDNVMAYWPQHSPDILVDEKMRQFRLSEQRLLPETLELE
QSDLALAYYTYHIKALVAMLNDDINLYVQKVANESELRTHQTHHELSSISWFIGLFALLA
LVITGFAGLYIYRNLGSNLTAIAGAMTRLARGERDVSVPALQRRDELGELARAFNVFARN
TASLEQTSRLLKEKSTQLETTFLAMRDGFALFDNDGQLVVWNPQYPLLLGLNEHQLHRGL
HYRELLQQVTPPAGQRWEAVLANLSSELPQPQELRLSDGRTVELRFSPVPNRGVVNVVLE
RTERKALEEALLHSQKMKAVGQLTGGLAHDFNNLLAVIIGSLELTTQQTQDAQTEQRIIR
ALKAAERGAQLTQRLLAFSRKQALHPQAITLQSLVENLQELLRHSLPSTLSLSIEAQRPG
WPAWIDANQLENALINLVVNARDAMEGRSGVVNIRIYNQRVVRSGGKKQDMVALEVIDTG
CGMSEEVKAQVFEPFFTTKAVGSGSGLGLSMVYGFVRQSGGRVQIETAPGKGTLVRLQLP
RAPTAAIEEVPAPQLEECKNTDNLVLVLEDENDVRHTLCEHLHQLGYLTLDSADSQEALA
LLRQTPDIDILISDLMLPGELDGVQVIGLAREINPQLTALLISGQDIRRQHEENLPNVEL
LRKPFSQRQLALALQRARRSNADGDAIRRE