Protein Info for IAI46_04545 in Serratia liquefaciens MT49

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 34 to 52 (19 residues), see Phobius details amino acids 59 to 77 (19 residues), see Phobius details amino acids 89 to 111 (23 residues), see Phobius details amino acids 117 to 136 (20 residues), see Phobius details amino acids 148 to 167 (20 residues), see Phobius details amino acids 173 to 193 (21 residues), see Phobius details amino acids 207 to 224 (18 residues), see Phobius details

Best Hits

KEGG orthology group: K07238, zinc transporter, ZIP family (inferred from 60% identity to adn:Alide_0229)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (229 amino acids)

>IAI46_04545 transporter (Serratia liquefaciens MT49)
MTSAVLYTLFPAAATVIGAAIALYRRPGDAAMRIIHHFTAGIVFAAAATEILPDLKQQSP
WAVLLGGAAGVLMMLLVRRLGERAQGPVGFVATVGVDIFIDGLVLGIAFAAGAKAGLLLT
LALTLEVLFLGLSIVGDLRDFFGRRIKAMLAIGGLALLLPLGGMLGAPIAMLGAFWLTAF
LAFGLIALLYLVTEELLVEAHEGGKDTPLATAMFFVGFLLLLLLEEGMG