Protein Info for IAI46_04490 in Serratia liquefaciens MT49

Annotation: DsbA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF13462: Thioredoxin_4" amino acids 43 to 184 (142 residues), 33.7 bits, see alignment E=4.1e-12 PF01323: DSBA" amino acids 46 to 201 (156 residues), 64.2 bits, see alignment E=1.5e-21

Best Hits

Swiss-Prot: 49% identical to DSBA_PECCC: Thiol:disulfide interchange protein DsbA (dsbA) from Pectobacterium carotovorum subsp. carotovorum

KEGG orthology group: None (inferred from 93% identity to spe:Spro_0983)

MetaCyc: 45% identical to thiol:disulfide oxidoreductase DsbA (Escherichia coli K-12 substr. MG1655)
RXN-21426 [EC: 1.8.4.15]; 1.8.4.15 [EC: 1.8.4.15]

Predicted SEED Role

"Thiol:disulfide interchange protein dsbA precursor"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (213 amino acids)

>IAI46_04490 DsbA family protein (Serratia liquefaciens MT49)
MLAKVNRLFAGALLALLLPAVAVAADYRAGEQYSRLDKPVASAPAVVEFFSFYCGPCYQF
AETYHVGSTVSQALPEGTKLTKYHVGLMGKLGNELTEAWSIAMVMGIEDKIEGLLFDELQ
KKRAINSEEDIQRVFAAAGVDAAAYENARHSLLVKGLIAKQNEAVKALDVRATPSFYVSG
KYKIDNAGMASQSVDGYAKEYAAVVRYLLDSQP