Protein Info for IAI46_04365 in Serratia liquefaciens MT49

Annotation: NADH:ubiquinone reductase (Na(+)-transporting) subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 transmembrane" amino acids 56 to 75 (20 residues), see Phobius details amino acids 126 to 148 (23 residues), see Phobius details amino acids 158 to 189 (32 residues), see Phobius details amino acids 268 to 290 (23 residues), see Phobius details amino acids 297 to 315 (19 residues), see Phobius details amino acids 327 to 346 (20 residues), see Phobius details amino acids 358 to 375 (18 residues), see Phobius details amino acids 381 to 401 (21 residues), see Phobius details TIGR01937: NADH:ubiquinone oxidoreductase, Na(+)-translocating, B subunit" amino acids 3 to 408 (406 residues), 650.8 bits, see alignment E=4.1e-200 PF03116: NQR2_RnfD_RnfE" amino acids 42 to 405 (364 residues), 346.9 bits, see alignment E=5.5e-108

Best Hits

Swiss-Prot: 87% identical to NQRB_YERPE: Na(+)-translocating NADH-quinone reductase subunit B (nqrB) from Yersinia pestis

KEGG orthology group: K00347, Na+-transporting NADH:ubiquinone oxidoreductase subunit B [EC: 1.6.5.-] (inferred from 99% identity to spe:Spro_0954)

MetaCyc: 77% identical to Na(+)-translocating NADH-quinone reductase subunit B (Vibrio cholerae)
TRANS-RXN-214 [EC: 7.2.1.1]

Predicted SEED Role

"Na(+)-translocating NADH-quinone reductase subunit B (EC 1.6.5.-)" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes (EC 1.6.5.-)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.-

Use Curated BLAST to search for 1.6.5.- or 7.2.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (413 amino acids)

>IAI46_04365 NADH:ubiquinone reductase (Na(+)-transporting) subunit B (Serratia liquefaciens MT49)
MGLKNFFDKIEHHFTPGGKLEKWYPLFEATTTVFYTPGLVTRGASHVRDAIDLKRMMILV
WLAVFPAMFWGMYNVGQQAIPALHHLYSGDQLQQVLAGDWHYRLAQWLGASLAADAGWVS
KMVLGACYFLPIYAVVFLVGGFWEVLFAIIRKHEINEGFFVTSILFALIVPPTLPLWQAA
LGITFGVVVAKEIFGGTGRNFLNPALAGRAFLFFAYPAQISGDLVWTSADGFSGATPLAQ
WSAGGAHSLSNVATGQSISWMDAFLGNIPGSVGEVSTLMILLGGAIILFGRVASWRIVAG
VMLGMMATAFLFNSIGSTTNPLFAMPWYWHLVLGGFAFGMIFMATDPVSASFTNKGKWWY
GILIGVMCVLIRVVNPAYPEGMMLAILFANLFAPLFDYLVVQANIKRRKARGE