Protein Info for IAI46_04350 in Serratia liquefaciens MT49

Annotation: murein L,D-transpeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03734: YkuD
  • amino acids 41 to 156 (116 residues), 36.9 bits, E=2.7e-13

Best Hits

Swiss-Prot: 62% identical to YAFK_ECO57: Putative L,D-transpeptidase YafK (yafK) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 95% identity to spe:Spro_0952)

MetaCyc: 62% identical to peptidoglycan meso-diaminopimelic acid protein amidase A (Escherichia coli K-12 substr. MG1655)
3.4.-.-; 3.4.-.-

Predicted SEED Role

"probable exported protein STY0357"

Protein Sequence (256 amino acids)

>IAI46_04350 murein L,D-transpeptidase (Serratia liquefaciens MT49)
MSKIALLFAMLFSMPMITACSASEQVPEAPVVKQQLVGSPVYIQIFKEERTLELYAKMGN
EFRLVNSFPICNFSGGLGPKRREGDFKSPEGFYSVDSRHLKPDSKYYRAINIGFPNDYDK
SQGYSGAYLMIHGECKSIGCYAMTNTYMDEIYRYVEAAFAYGQSRIDISIYPFRMTDQNL
KRHSSSNYIAFWRQLKPGYDYFVKNHQPPMVGVSNGQYVLGQPLMSSSQMTQYASTTAPA
VSTNPFAQAKPLTEVK