Protein Info for IAI46_04290 in Serratia liquefaciens MT49

Annotation: purine permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 27 to 49 (23 residues), see Phobius details amino acids 56 to 74 (19 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 139 to 162 (24 residues), see Phobius details amino acids 174 to 192 (19 residues), see Phobius details amino acids 203 to 226 (24 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details amino acids 325 to 344 (20 residues), see Phobius details amino acids 350 to 371 (22 residues), see Phobius details amino acids 383 to 405 (23 residues), see Phobius details amino acids 411 to 434 (24 residues), see Phobius details TIGR00801: uracil-xanthine permease" amino acids 19 to 433 (415 residues), 358.6 bits, see alignment E=4.7e-111 PF00860: Xan_ur_permease" amino acids 23 to 402 (380 residues), 306.4 bits, see alignment E=1.2e-95 TIGR03173: xanthine permease" amino acids 27 to 435 (409 residues), 509.7 bits, see alignment E=5.3e-157

Best Hits

Swiss-Prot: 39% identical to NUCLP_PAELB: Nucleobase transporter PlUacP (PL1_3014) from Paenibacillus larvae subsp. larvae (strain NRRL B-3650 / LMG 16245)

KEGG orthology group: None (inferred from 93% identity to srr:SerAS9_0863)

MetaCyc: 39% identical to urate:H+ symporter (Escherichia coli K-12 substr. MG1655)
RXN-5076; TRANS-RXN0-530

Predicted SEED Role

"Xanthine permease" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (450 amino acids)

>IAI46_04290 purine permease (Serratia liquefaciens MT49)
MALSQDKGAASCCPEDEKLPLAKTFAYGLQHILTMYGGIIAPPLIIGSAAGLDAAQIGLL
VTAALFVSGLATLLQTLGAPGFGSRLPLVQGVSFAGVATMVTIVTGDGGLPAVFGAVIAA
SLIGLLIAPFFSQIIRYFPPVVTGTVVTVIGLSLMPVAVRWAMGGNAKAADWGSTGNIGL
AAFTLAVILLLNKVGSPALKRLSVLLAMAVGCVAAAWVGKLSFVAVGHGPWLAFPAPFAY
GWPTFELSAVLSMLLIVLVLLTETTAGLMAVGEIVGSPVNARRIANGLRADMLSSALSPV
FNSFPQSSFAQNIGLVAITGVKSRFVVSAGGAILVLLGLLPVLGRLVACIPLPVLGGAGV
VLFGSVAASGIRTLAKVEYKDNMNLVVVATAIAFGMIPIVMPTFYDQFPNWVRTLLHSGI
SASCLVALLLNLLFNRIGGTEEKAAEEELS