Protein Info for IAI46_04285 in Serratia liquefaciens MT49

Annotation: hydroxyisourate hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02962: hydroxyisourate hydrolase
  • amino acids 2 to 111 (110 residues), 129.8 bits, E=2.9e-42
• PF00576: Transthyretin
  • amino acids 4 to 110 (107 residues), 123.3 bits, E=3.4e-40

Best Hits

Swiss-Prot: 43% identical to HIUH_SALTY: 5-hydroxyisourate hydrolase (hiuH) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 84% identity to srr:SerAS9_0862)

MetaCyc: 57% identical to hydroxyisourate hydrolase (Klebsiella michiganensis M5al)
Hydroxyisourate hydrolase. [EC: 3.5.2.17]

Predicted SEED Role

"5-Hydroxyisourate Hydrolase (HIUase) (EC 3.5.2.17)" (EC 3.5.2.17)

MetaCyc Pathways

• ureide biosynthesis (6/7 steps found)
• superpathway of purines degradation in plants (13/18 steps found)
• urate conversion to allantoin I (2/3 steps found)
• urate conversion to allantoin II (2/3 steps found)
• urate conversion to allantoin III (1/3 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.17

Protein Sequence (111 amino acids)

>IAI46_04285 hydroxyisourate hydrolase (Serratia liquefaciens MT49)
MSNISTHILDTSLGKPAAKVRVWLEREQQGQWRAIAEGTTDADGRARELTPDELPAGHYR
LHADVGGYFTADNRETLYATAIIDFVIKDAAQHYHLPLLISPYSYSTYRGS