Protein Info for IAI46_04260 in Serratia liquefaciens MT49

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details amino acids 87 to 110 (24 residues), see Phobius details amino acids 142 to 166 (25 residues), see Phobius details amino acids 184 to 202 (19 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 11 to 106 (96 residues), 93 bits, see alignment E=6.7e-31 PF00528: BPD_transp_1" amino acids 43 to 211 (169 residues), 54.2 bits, see alignment E=7.9e-19

Best Hits

Swiss-Prot: 35% identical to YECS_SHIFL: L-cystine transport system permease protein YecS (yecS) from Shigella flexneri

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 96% identity to spe:Spro_0934)

MetaCyc: 35% identical to cystine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-290 [EC: 7.4.2.12]; 7.4.2.12 [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]

Predicted SEED Role

"Putative amino acid ABC transporter, permease protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (218 amino acids)

>IAI46_04260 amino acid ABC transporter permease (Serratia liquefaciens MT49)
MLTFTDWDIVRNLLLAARWTLLLSLTAFFGGTLVTLPLLLLRLSKRRWALRFVRCYSELF
QGTPLLMQLFLAFFGLALFGIDVSPWAAAALALTLFTSAFLVDIWSGSIAALPKGQWEAS
RCLGLSFGQTLVRVVVPQAIRIAIAPTVGFSVQVIKGTALASIIGFVELTKAGTMLNNVT
YQPFKVFGLVALGYFLMCYPLSRYSHYLERKFHAAHHN