Protein Info for IAI46_04205 in Serratia liquefaciens MT49

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 51 to 72 (22 residues), see Phobius details amino acids 84 to 107 (24 residues), see Phobius details amino acids 115 to 135 (21 residues), see Phobius details amino acids 154 to 177 (24 residues), see Phobius details amino acids 183 to 201 (19 residues), see Phobius details amino acids 222 to 243 (22 residues), see Phobius details amino acids 261 to 281 (21 residues), see Phobius details amino acids 288 to 306 (19 residues), see Phobius details amino acids 312 to 335 (24 residues), see Phobius details amino acids 348 to 370 (23 residues), see Phobius details amino acids 376 to 395 (20 residues), see Phobius details PF07690: MFS_1" amino acids 22 to 360 (339 residues), 70.1 bits, see alignment E=8.7e-24

Best Hits

KEGG orthology group: None (inferred from 92% identity to spe:Spro_0923)

Predicted SEED Role

"FIG00639052: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>IAI46_04205 MFS transporter (Serratia liquefaciens MT49)
MHISSPPKSPPIANTSPSNWPLALCAGLLGIGQNGLLVALPVLVSMTQLSLSVWAGLLTL
GSMLFLVGSPWWGRQSEIRGCKFVVTMALAGYLFSFALLALAVWGLAAGWLSSTLGLGGL
IAARIIYGLTVSGMVPASQTWALQRAGYEQRMSALATISSGLSCGRLLGPLCAALTLSIH
PMAPLWLMALAPLIALLVVCRQHNDPPLPPVAHQQNRLRLNMMPYLLCALLLAASVSLMQ
LGLAPHLTGLFSHSATTVSHHVAVLLSVAAACTLLAQFLVVRPQRFSASQLLLIAAVLMI
VGLGLMCAQPLALFYVGCALASFGAAMATPGYQLMLNEKLSTGKGSGAIATSHTLGYGLS
ALMVPVVAKFYGESQLIAAALTMAVLLGGISGWLWRQHRISANSAGE