Protein Info for IAI46_04120 in Serratia liquefaciens MT49

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 40 to 62 (23 residues), see Phobius details amino acids 69 to 87 (19 residues), see Phobius details amino acids 98 to 120 (23 residues), see Phobius details amino acids 128 to 150 (23 residues), see Phobius details amino acids 160 to 182 (23 residues), see Phobius details amino acids 203 to 225 (23 residues), see Phobius details amino acids 235 to 256 (22 residues), see Phobius details amino acids 267 to 285 (19 residues), see Phobius details amino acids 291 to 315 (25 residues), see Phobius details amino acids 327 to 349 (23 residues), see Phobius details amino acids 361 to 380 (20 residues), see Phobius details PF07690: MFS_1" amino acids 8 to 319 (312 residues), 161.7 bits, see alignment E=3.6e-51 amino acids 225 to 378 (154 residues), 54.6 bits, see alignment E=1.4e-18 PF06779: MFS_4" amino acids 12 to 375 (364 residues), 56.9 bits, see alignment E=3.6e-19 PF00083: Sugar_tr" amino acids 39 to 154 (116 residues), 23.7 bits, see alignment E=3.2e-09

Best Hits

Swiss-Prot: 53% identical to YTBD_BACSU: Uncharacterized MFS-type transporter YtbD (ytbD) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 97% identity to spe:Spro_0906)

Predicted SEED Role

"Putative drug efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (391 amino acids)

>IAI46_04120 MFS transporter (Serratia liquefaciens MT49)
MPLALLALTISAFAIGTTEFVIVGLIPTIAEQLGVTVPSAGLLVTIYAIGVAIGAPVLTA
LTGRVPRKLLLISLMVLFTLGNLLAWQSPSYESLVVARLLTGLAHGVFFSIGSTIATSLV
AKEKAASAIAIMFGGLTVALVTGVPLGTFIGQHFGWRETFLAVSLIGVIATVASVILVPN
NIKNQASASIGEQFKVLTHPRLLLIYAITALGYGGVFTTFTFLAPMMQELAGFSAPAVSW
ILLAYGIAVAIGNIWGGKLADRHGAVRALSFIFAALAVLLLVFQFTASHSIAALMTVVVM
GVFAFGNVPGLQVYVVQKAEQYTPNAVDVASGLNIAAFNVGIALGSVIGGQTVSTLGLAQ
TPWIGALIVLVALLLVGVSGRLDKKYRQQLA