Protein Info for IAI46_03950 in Serratia liquefaciens MT49

Annotation: anaerobic C4-dicarboxylate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 transmembrane" amino acids 6 to 39 (34 residues), see Phobius details amino acids 50 to 73 (24 residues), see Phobius details amino acids 92 to 116 (25 residues), see Phobius details amino acids 135 to 161 (27 residues), see Phobius details amino acids 170 to 191 (22 residues), see Phobius details amino acids 234 to 255 (22 residues), see Phobius details amino acids 275 to 292 (18 residues), see Phobius details amino acids 303 to 324 (22 residues), see Phobius details amino acids 346 to 370 (25 residues), see Phobius details amino acids 382 to 400 (19 residues), see Phobius details amino acids 420 to 444 (25 residues), see Phobius details TIGR00770: transporter, anaerobic C4-dicarboxylate uptake (Dcu) family" amino acids 5 to 445 (441 residues), 519.3 bits, see alignment E=4.5e-160 PF03605: DcuA_DcuB" amino acids 5 to 380 (376 residues), 483.9 bits, see alignment E=1.5e-149

Best Hits

KEGG orthology group: K07792, anaerobic C4-dicarboxylate transporter DcuB (inferred from 89% identity to yps:YPTB0839)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (448 amino acids)

>IAI46_03950 anaerobic C4-dicarboxylate transporter (Serratia liquefaciens MT49)
MITLQFLIIIICLLVGTRFGGMGLGLISGIGLFLLCFIFGLEPGKPPVEVMLTILAVIGC
ASVLQTAGGLNVMMQYAERLLRRHPQYITLLAPFTTWTLTFLCGTGHVVYTMFPIISDIA
IKKGIRPERPMAVASVASQMAITASPVSVAVVSLVSIIAAGHGIGKAYTLVEILAVSIPA
SLVGVLMAALWSLRRGKDLDKDAEFQEKIKDPEQRAYIFGSTETLLNQRFPKQAYWSTAI
FFAAIAIVVLLGAFADLRPSFANAKGVLKPLSMNLVIQMMMLIAGAVILMGCKVKPGDIA
NGAVFKAGMVAIFSVFGVAWMSDTFFQAHMGELKLLLEDVVKSQPWTYAIVLFLVSKLVN
SQAAALTAIAPMALQLGVDPKMLLAFFPAAYGYFVLPTYPSDLACIGFDRSGTTRIGKFI
INHSFIIPGLIGVLCSCITGYLLVTTFL