Protein Info for IAI46_03780 in Serratia liquefaciens MT49

Annotation: protein-L-isoaspartate(D-aspartate) O-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 TIGR00080: protein-L-isoaspartate O-methyltransferase" amino acids 1 to 207 (207 residues), 306 bits, see alignment E=8e-96 PF01135: PCMT" amino acids 6 to 206 (201 residues), 262.1 bits, see alignment E=6.3e-82 PF00398: RrnaAD" amino acids 62 to 131 (70 residues), 28.5 bits, see alignment E=1.2e-10 PF13649: Methyltransf_25" amino acids 79 to 150 (72 residues), 27.6 bits, see alignment E=6e-10

Best Hits

Swiss-Prot: 98% identical to PIMT_SERP5: Protein-L-isoaspartate O-methyltransferase (pcm) from Serratia proteamaculans (strain 568)

KEGG orthology group: K00573, protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC: 2.1.1.77] (inferred from 98% identity to spe:Spro_0830)

MetaCyc: 83% identical to protein-L-isoaspartate O-methyltransferase (Escherichia coli K-12 substr. MG1655)
Protein-L-isoaspartate(D-aspartate) O-methyltransferase. [EC: 2.1.1.77]

Predicted SEED Role

"Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77)" in subsystem Ton and Tol transport systems (EC 2.1.1.77)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.77

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (208 amino acids)

>IAI46_03780 protein-L-isoaspartate(D-aspartate) O-methyltransferase (Serratia liquefaciens MT49)
MVNKRMQTLLTQLRQQGIQDERLLRAIEAVPRERFVDEALEHKAYENTALPIGSGQTISQ
PYMVARMTELLNLTPTSRVLEIGTGSGYQTAILAHLVQHVCSVERIKGLQWQAKRRLKQL
DLHNVSTRHGDGWQGWASRGPFDAIIVTAAPPEIPPALMEQLDDGGILVLPVGEQAQTLK
RIQRQGNEFVIDTVEAVRFVPLVKGELA