Protein Info for IAI46_03770 in Serratia liquefaciens MT49

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 67 to 84 (18 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 137 to 155 (19 residues), see Phobius details amino acids 190 to 208 (19 residues), see Phobius details amino acids 215 to 236 (22 residues), see Phobius details amino acids 242 to 264 (23 residues), see Phobius details amino acids 280 to 298 (19 residues), see Phobius details amino acids 309 to 328 (20 residues), see Phobius details amino acids 340 to 362 (23 residues), see Phobius details amino acids 368 to 386 (19 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 63 to 387 (325 residues), 91.5 bits, see alignment E=5.8e-30 PF10129: OpgC_C" amino acids 64 to 154 (91 residues), 28.4 bits, see alignment E=8.2e-11

Best Hits

Predicted SEED Role

"acyltransferase 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (426 amino acids)

>IAI46_03770 acyltransferase (Serratia liquefaciens MT49)
MFTAPAMSSDHGKSPQCYPQFHGEDLKIITQSLRKSDNTVALKYNFRSMNSRFICPMSII
RLKYLDGLRGVFSLTVALSHFFGSQYSWHNYPFQNAYISVDFFFILSGFVLSHVYSQAIS
SGLMSDRKFIFYRFARMYPLHIATMAIVGIIYLLTLRGFPFDEPFISGIANIFLLQNMGF
VNNWSWNDPSWSISVEFWVSVFLVPWCIRRVKTNMLLFISLMCYTVLYTSFGSLMIAHEM
MYGIVTSGFVRCIAGVTLGIAVCRMAQGMRQVELNHIQKSIIGCIDVILFATVVYLVYQK
NPIGKFSFLPIPLIALLILSLATLSSWFHQVISSRIPAWLGDISYSVYLIHTPIILIMGA
ALSPLNLPFVIKLLIFVALTLLLSQLTHRFFEKPCYEWLKNRFSDQSQANVKEIKLKEEK
KFANQR