Protein Info for IAI46_03725 in Serratia liquefaciens MT49

Annotation: adenylyl-sulfate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00455: adenylyl-sulfate kinase
  • amino acids 18 to 201 (184 residues), 290.1 bits, E=3.2e-91
• PF01583: APS_kinase
  • amino acids 35 to 188 (154 residues), 246.6 bits, E=1.1e-77
• PF13671: AAA_33
  • amino acids 38 to 150 (113 residues), 32.9 bits, E=7.4e-12

Best Hits

Swiss-Prot: 82% identical to CYSC_YERPE: Adenylyl-sulfate kinase (cysC) from Yersinia pestis

KEGG orthology group: K00860, adenylylsulfate kinase [EC: 2.7.1.25] (inferred from 95% identity to srs:SerAS12_0747)

MetaCyc: 81% identical to adenylyl-sulfate kinase (Escherichia coli K-12 substr. MG1655)
Adenylyl-sulfate kinase. [EC: 2.7.1.25]

Predicted SEED Role

"Adenylylsulfate kinase (EC 2.7.1.25)" in subsystem Cysteine Biosynthesis or O-Methyl Phosphoramidate Capsule Modification in Campylobacter (EC 2.7.1.25)

MetaCyc Pathways

• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (10/12 steps found)
• assimilatory sulfate reduction I (4/4 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (8/10 steps found)
• sulfate activation for sulfonation (2/2 steps found)
• assimilatory sulfate reduction IV (3/4 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.25

Protein Sequence (209 amino acids)

>IAI46_03725 adenylyl-sulfate kinase (Serratia liquefaciens MT49)
MTDAQLRPTGPDDDNVVWHPHAVTRADREARNGHKGVVLWFTGLSGSGKSTVAGALEQAL
HAHGVSTYLLDGDNVRHGLCRDLGFSDDDRRENIRRVGEVAKLMVDAGLVVLTAFISPHR
AERQMVRELLDEERFIEVFVDTPLAVCEVRDPKGLYKKARAGELRNFTGIDSVYEAPQRP
DIHLDGQQLVTNLIAQLLDVLRGRAIIKP