Protein Info for IAI46_03695 in Serratia liquefaciens MT49

Annotation: phosphoadenylyl-sulfate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02057: phosphoadenosine phosphosulfate reductase
  • amino acids 21 to 242 (222 residues), 311.2 bits, E=4.9e-97
• TIGR00434: phosophoadenylyl-sulfate reductase
  • amino acids 33 to 243 (211 residues), 295.5 bits, E=2.8e-92
• PF01507: PAPS_reduct
  • amino acids 48 to 220 (173 residues), 186.5 bits, E=2.2e-59

Best Hits

Swiss-Prot: 98% identical to CYSH_SERP5: Phosphoadenosine phosphosulfate reductase (cysH) from Serratia proteamaculans (strain 568)

KEGG orthology group: K00390, phosphoadenosine phosphosulfate reductase [EC: 1.8.4.8] (inferred from 98% identity to spe:Spro_0812)

MetaCyc: 81% identical to phosphoadenosine phosphosulfate reductase (Escherichia coli K-12 substr. MG1655)
Phosphoadenylyl-sulfate reductase (thioredoxin). [EC: 1.8.4.8]

Predicted SEED Role

"Phosphoadenylyl-sulfate reductase [thioredoxin] (EC 1.8.4.8)" in subsystem Cysteine Biosynthesis (EC 1.8.4.8)

MetaCyc Pathways

• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (10/12 steps found)
• assimilatory sulfate reduction I (4/4 steps found)
• assimilatory sulfate reduction III (3/3 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (8/10 steps found)
• assimilatory sulfate reduction IV (3/4 steps found)

KEGG Metabolic Maps

• Sulfur metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.8

Protein Sequence (244 amino acids)

>IAI46_03695 phosphoadenylyl-sulfate reductase (Serratia liquefaciens MT49)
MAEFDLAALNALPKSGQALALAVVNGQLETLSAEQRVEWALEHLPGEFVLSSSFGIQAAV
CLHLVTRIKPDIPVILTDTGYLFPETYQFIDQLVDKLKLNLQVFRAEQSPAWQEARYGKL
WEQGVEGIEKYNLINKVEPMNRALETLGGQTWFAGLRREQSGSRANLPVLAVQRGVFKIL
PIIDWDNRKIYQYLTEHGLSYHPLWEQGYLSVGDTHTTQKWEPGMSEEETRFFGLKRECG
LHEG