Protein Info for IAI46_03680 in Serratia liquefaciens MT49

Annotation: 6-carboxytetrahydropterin synthase QueD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00039: 6-pyruvoyl tetrahydropterin synthase/QueD family protein
  • amino acids 3 to 118 (116 residues), 126.3 bits, E=8.4e-41
• PF01242: PTPS
  • amino acids 5 to 118 (114 residues), 127.7 bits, E=1.2e-41
• TIGR03367: queuosine biosynthesis protein QueD
  • amino acids 5 to 96 (92 residues), 113 bits, E=6.9e-37

Best Hits

Swiss-Prot: 84% identical to QUED_SHIFL: 6-carboxy-5,6,7,8-tetrahydropterin synthase (queD) from Shigella flexneri

KEGG orthology group: None (inferred from 98% identity to srr:SerAS9_0739)

MetaCyc: 84% identical to 6-carboxy-5,6,7,8-tetrahydropterin synthase (Escherichia coli K-12 substr. MG1655)
RXN0-5507 [EC: 4.1.2.50]

Predicted SEED Role

"6-carboxytetrahydropterin synthase (EC 4.1.2.50) @ Queuosine biosynthesis QueD, PTPS-I" (EC 4.1.2.50)

MetaCyc Pathways

• preQ₀ biosynthesis (3/4 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.50

Protein Sequence (119 amino acids)

>IAI46_03680 6-carboxytetrahydropterin synthase QueD (Serratia liquefaciens MT49)
MATTLFKDFQFEAAHRLPHVPEGHKCGRLHGHSFMVRLEVTGEVDAHTGWVMDFAELKAV
FSPIWERLDHHYLNDIPGLENPTSEVLAAWIWQQLKPQLPELTAVMVKETCTAGCVYKG