Protein Info for IAI46_03670 in Serratia liquefaciens MT49

Annotation: aromatic acid/H+ symport family MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 61 to 79 (19 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details amino acids 149 to 172 (24 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details amino acids 261 to 283 (23 residues), see Phobius details amino acids 296 to 316 (21 residues), see Phobius details amino acids 324 to 341 (18 residues), see Phobius details amino acids 347 to 365 (19 residues), see Phobius details amino acids 385 to 408 (24 residues), see Phobius details amino acids 414 to 433 (20 residues), see Phobius details PF07690: MFS_1" amino acids 30 to 297 (268 residues), 132.6 bits, see alignment E=2.5e-42 amino acids 263 to 442 (180 residues), 71 bits, see alignment E=1.3e-23 PF00083: Sugar_tr" amino acids 37 to 275 (239 residues), 86.8 bits, see alignment E=2.3e-28 PF06779: MFS_4" amino acids 46 to 200 (155 residues), 29.7 bits, see alignment E=6.8e-11

Best Hits

Swiss-Prot: 51% identical to PCAK_ACIAD: 4-hydroxybenzoate transporter PcaK (pcaK) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: None (inferred from 97% identity to srr:SerAS9_0737)

Predicted SEED Role

"4-hydroxybenzoate transporter" in subsystem Cinnamic Acid Degradation or Gentisare degradation or Phenylpropanoid compound degradation or Salicylate and gentisate catabolism or p-Hydroxybenzoate degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (448 amino acids)

>IAI46_03670 aromatic acid/H+ symport family MFS transporter (Serratia liquefaciens MT49)
MAHSTELNIQQAIDDSKFSLFHWTLIILGFLILAIDGFDTAAMGYIAPSVAKDWGIVKQD
LGPVLSAALLGLSLGALVAGPISDRIGRKRVLVFSCLFFGLSSLATAYAGSLNSLTLWRF
LTGLGLGAAMPNAITLISEYAPQRCRSLAINTMYCGFPLGAAGGGAISSWLIPAYGWHSV
LLLGAIAPLALTVLLILFLPESVKYMVNRGKDAAKIKRIAQRFVSQNLDNVTRFYLYEEK
LAQSKTSVGLLFTRPYLTGTLMLWLTYFMGLVIYYVLLSWMPILMQGLGYQLEQSAILTS
LFTFGGTLGILVAGWLMDRWNAHKVVSSGFVITALLIVAMATEDSHIVLLGTFIFLMGIT
MNGAQSGLQTLAATFYPTHSRATGIAWMQGIGRFGGVAGTMMGAQLLAMQWEVQSILMFL
CVPALIAAIATVFKMTRRATLQPADKPV