Protein Info for IAI46_03655 in Serratia liquefaciens MT49

Annotation: amino acid permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 transmembrane" amino acids 19 to 38 (20 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 95 to 118 (24 residues), see Phobius details amino acids 125 to 146 (22 residues), see Phobius details amino acids 155 to 177 (23 residues), see Phobius details amino acids 198 to 221 (24 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details amino acids 281 to 303 (23 residues), see Phobius details amino acids 331 to 352 (22 residues), see Phobius details amino acids 358 to 377 (20 residues), see Phobius details amino acids 397 to 419 (23 residues), see Phobius details amino acids 425 to 444 (20 residues), see Phobius details PF00324: AA_permease" amino acids 16 to 448 (433 residues), 378.6 bits, see alignment E=4.3e-117 PF13520: AA_permease_2" amino acids 19 to 428 (410 residues), 123.8 bits, see alignment E=9.4e-40

Best Hits

Swiss-Prot: 60% identical to PROY_SALTY: Proline-specific permease ProY (proY) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03293, amino acid transporter, AAT family (inferred from 96% identity to srs:SerAS12_0734)

MetaCyc: 45% identical to aromatic amino acid:H+ symporter AroP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-56; TRANS-RXN-76; TRANS-RXN-77

Predicted SEED Role

"Histidine transport protein (permease)" in subsystem Histidine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (460 amino acids)

>IAI46_03655 amino acid permease (Serratia liquefaciens MT49)
MHNETKQLRRGLNARHIRFMALGSAIGTGLFYGSAGAIQLAGPAVLLAYLVGGAAVFMVM
RALGEMAVHQPVSGSFGHYASHYLGPLAGFLTGWTYTFEMVIVALADVTAFGIYMGLWFP
DVAQWVWVLSIIMFIGALNLCSVKVFGEMEFWLSLIKVAAIVAMIIGGAAVMLFGFGQTQ
HATGLSNLWQHGGFMPNGIGGVVASLAVVMFAFGGIEIIGITASEAKDPAKVLPKAINAV
PIRILLFYVLTLLVLMAIYPWNSIGQNGSPFVEIFSNLGISSAANVLNVVVITAAISAIN
SDIFGAGRMMYGMAQEGQAPKSFTRLTGNGVPWMTVLVMSIALLLGVVLNYLIPKQVFMI
IATFATVWVWLMILLSQIAMRRTLTPQEVSKLSFPVPWWPVAPALATIFMLFVIGLLGYF
EDSRIALYVGLVWVAFLTLAYWLWVRKKGGGSPVTSSPQY