Protein Info for IAI46_03645 in Serratia liquefaciens MT49

Annotation: proline/glycine betaine ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 transmembrane" amino acids 38 to 64 (27 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 95 to 118 (24 residues), see Phobius details amino acids 139 to 165 (27 residues), see Phobius details amino acids 207 to 234 (28 residues), see Phobius details amino acids 242 to 267 (26 residues), see Phobius details PF00528: BPD_transp_1" amino acids 110 to 270 (161 residues), 95.2 bits, see alignment E=2.1e-31

Best Hits

KEGG orthology group: K02001, glycine betaine/proline transport system permease protein (inferred from 98% identity to spe:Spro_0801)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (281 amino acids)

>IAI46_03645 proline/glycine betaine ABC transporter permease (Serratia liquefaciens MT49)
MFPERFTFSIADWINRWVDVLVTNYGDMFRKISDTLLWAVIHLESLLRATPWWVMLAVVG
LLAWHATRRWLPTLVIVGLLLLVGTAGMWDKLMQTLALVLVATLLAVIIGIPQGILAARS
DRVRAVMMPLMDVMQTMPSFVYLIPVLMLFGLGKVPAILATVIYATPPLIRLTDLGIRQV
DKEVMESVTAFGANRWQKLFGVQLPLALPSIMAGINQTTMMSLSMVVVASMIGARGLGED
VLVGIQTLNVGLGLEAGLAIVILAVVIDRITQAYGHTAVAR