Protein Info for IAI46_03640 in Serratia liquefaciens MT49

Annotation: glycine betaine/L-proline ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01186: glycine betaine/L-proline transport ATP binding subunit
  • amino acids 37 to 266 (230 residues), 362 bits, E=1.8e-112
• PF00005: ABC_tran
  • amino acids 43 to 191 (149 residues), 126 bits, E=1.7e-40

Best Hits

KEGG orthology group: K02000, glycine betaine/proline transport system ATP-binding protein [EC: 3.6.3.32] (inferred from 97% identity to spe:Spro_0800)

Predicted SEED Role

"Histidine ABC transporter, ATP-binding protein (TC 3.A.1)"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.32

Use Curated BLAST to search for 3.6.3.32

Protein Sequence (285 amino acids)

>IAI46_03640 glycine betaine/L-proline ABC transporter ATP-binding protein (Serratia liquefaciens MT49)
MNKIEIKNVYKIFGHKTAAALELSQQGKTKQEVQAATDCVIGVHDLSMSIEAGEIFVIMG
LSGSGKSTLVRHFNRLIDPTSGQILVDGEDILRYDEKQLEHFRRHKISMVFQSFGLLPHK
TVLDNVGYGLKVRGENKEVYQERALHWINTVGLKGYEKSYPHQLSGGMRQRVGLARALAT
DTDIILLDEAFSALDPLIRAEMQDQLLALQKELHKTLVFITHDLDEAVRIGNRIAILKDG
KLIQVGTPQDILNNPADEYVNRFVQRRLALDENVQKPRPRRVAHA