Protein Info for IAI46_03595 in Serratia liquefaciens MT49

Annotation: 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01938: TRAM
  • amino acids 19 to 69 (51 residues), 39.8 bits, 1.2e-13
• TIGR00479: 23S rRNA (uracil-5-)-methyltransferase RumA
  • amino acids 27 to 433 (407 residues), 459.4 bits, E=6e-142
• PF05958: tRNA_U5-meth_tr
  • amino acids 104 to 437 (334 residues), 92.7 bits, E=8.6e-30
• PF01135: PCMT
  • amino acids 281 to 347 (67 residues), 26.4 bits, E=2e-09
• PF02475: Met_10
  • amino acids 293 to 370 (78 residues), 22.9 bits, E=2.3e-08
• PF13847: Methyltransf_31
  • amino acids 294 to 372 (79 residues), 42.3 bits, E=2.4e-14
• PF13649: Methyltransf_25
  • amino acids 299 to 371 (73 residues), 28 bits, E=1.1e-09

Best Hits

Swiss-Prot: 74% identical to RLMD_YERE8: 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (rlmD) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K03215, RNA methyltransferase, TrmA family [EC: 2.1.1.-] (inferred from 74% identity to yen:YE0743)

Predicted SEED Role

"23S rRNA (Uracil-5-) -methyltransferase RumA (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (449 amino acids)

>IAI46_03595 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (Serratia liquefaciens MT49)
MAQFYSPKRRVTTRQNSPVLTLTVDNLDPFGQGVAHHNGKAIFVPGVLPGEQAEVQLTEE
KNKFAKGRLKRLLSRSPQRVEPRCPHFGVCGGCQQQHADESLQQQSKAAALVRMIARETG
VTPQQEPVIAGPQYGYRRRARLGLLWQPKQQRLVMGFRQAASSDLVPVTRCPVLHPELEQ
LLTPLRSCLSALQVARRLGHVELVLADNGPVLVLRHLDALKEDDRQALQAFARTKNVTIY
LAPDSDSLEKLCGETPYYQVDGLRLDFSPRDFIQVNDHVNQQMVAQALEWLSIQPNDRVL
DLFCGMGNFTLPLARRAAAVVGIEGVATLVANGQYNAHNNRLNNASFFHENLEEDVEQQP
WAAQGFDKVMLDPARAGAAGVMSHIVKLAPERVVYVSCNPTTLARDSKVLLSAGYRLARV
RMLDMFPHTGHLESMALFINGSAPEVAAK