Protein Info for IAI46_03570 in Serratia liquefaciens MT49

Annotation: vitamin B12 ABC transporter substrate-binding protein BtuF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01497: Peripla_BP_2
  • amino acids 26 to 222 (197 residues), 78.2 bits, E=3.4e-26

Best Hits

Swiss-Prot: 70% identical to BTUF_YERPB: Vitamin B12-binding protein (btuF) from Yersinia pseudotuberculosis serotype IB (strain PB1/+)

KEGG orthology group: K06858, vitamin B12 transport system substrate-binding protein (inferred from 93% identity to spe:Spro_0786)

MetaCyc: 54% identical to vitamin B12 ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-5-RXN [EC: 7.6.2.8]; 7.6.2.8 [EC: 7.6.2.8]

Predicted SEED Role

"Vitamin B12 ABC transporter, B12-binding component BtuF" in subsystem Coenzyme B12 biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.8

Protein Sequence (268 amino acids)

>IAI46_03570 vitamin B12 ABC transporter substrate-binding protein BtuF (Serratia liquefaciens MT49)
MTRRFSALLWLLALWVALPVGAAQRVISLAPNTTELAYAAGMGDTLLAVSAYSDYPPAAK
KLEQVASWQGINLERVLALKPDLILAWRGGNPQRVLDQLATFGIPIFYADATTLDDIPRS
LDQLAQYSPHPEQAHLAAEALRQQIADLKNKYPHTQPRRVLLQFGTQPLFTTSGATLQSQ
VLSLCGAENIFADSRMPWPQISREQVLARQPQAIVITGDQKEIASVKAFWAPQLQVPVIA
LNGDWFNRAGPRIMLAAQQLCSQLAEIR