Protein Info for IAI46_03555 in Serratia liquefaciens MT49

Annotation: iron-sulfur cluster insertion protein ErpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 114 TIGR00049: iron-sulfur cluster assembly accessory protein" amino acids 9 to 114 (106 residues), 130 bits, see alignment E=1.9e-42 PF01521: Fe-S_biosyn" amino acids 9 to 109 (101 residues), 72.1 bits, see alignment E=2.2e-24

Best Hits

Swiss-Prot: 99% identical to ERPA_SERP5: Iron-sulfur cluster insertion protein ErpA (erpA) from Serratia proteamaculans (strain 568)

KEGG orthology group: None (inferred from 99% identity to spe:Spro_0783)

Predicted SEED Role

"probable iron binding protein from the HesB_IscA_SufA family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (114 amino acids)

>IAI46_03555 iron-sulfur cluster insertion protein ErpA (Serratia liquefaciens MT49)
MSDETALPLQFTEAAASKVKVLIADEENPNLKLRVYITGGGCSGFQYGFTFDDKVNDGDM
TIEKQGVALVVDPMSLQYLVGGSVDYTEGLEGSRFVVTNPNAKTTCGCGSSFSV