Protein Info for IAI46_03515 in Serratia liquefaciens MT49

Annotation: protein transport protein HofC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 transmembrane" amino acids 165 to 187 (23 residues), see Phobius details amino acids 207 to 233 (27 residues), see Phobius details amino acids 253 to 272 (20 residues), see Phobius details amino acids 278 to 298 (21 residues), see Phobius details amino acids 371 to 392 (22 residues), see Phobius details PF00482: T2SSF" amino acids 64 to 187 (124 residues), 110.8 bits, see alignment E=2.3e-36 amino acids 269 to 390 (122 residues), 96.5 bits, see alignment E=6.1e-32

Best Hits

KEGG orthology group: K02505, protein transport protein HofC (inferred from 88% identity to spe:Spro_0776)

Predicted SEED Role

"Type IV fimbrial assembly protein PilC" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (399 amino acids)

>IAI46_03515 protein transport protein HofC (Serratia liquefaciens MT49)
MKTLRLFLWQAIDPHGQLREGELMSGKKNEVSQWLIEQGLQPCQINSGKRISPGQWRGEP
LIQFTRQLATLLQAGLPLVSGLQLLAAEHPSAAWRCLLREVSEQVRQGQPFSEVIAEQHA
VFPLIYRQLIAIGELTGHLDECCLQLAQQQEAQQKLQKKVIKALRYPLFICAVALLVSIL
MLVMVLPEFAGVYQSFNAPLPWFTQGLLNLSTLLIDSGPWLAAILVCMAYTYLRRLHPQP
QWRRREQAALLRLPLIAHLIKGGCLSQIFRILAMTQQAGLSLVDGLAAAALSVDNLFYRQ
AIDNIRQQISQGQTFHRALEQQALFPTLCQQLVRVGEESGSLDTLLGKLAAWHEQQTFEL
ADTLAQTLEPLLMLVVGGIVGTLVIAMYLPIFQLGNVLG