Protein Info for IAI46_03505 in Serratia liquefaciens MT49

Annotation: dephospho-CoA kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 74% identical to COAE_YERPS: Dephospho-CoA kinase (coaE) from Yersinia pseudotuberculosis serotype I (strain IP32953)

KEGG orthology group: K00859, dephospho-CoA kinase [EC: 2.7.1.24] (inferred from 96% identity to spe:Spro_0774)

MetaCyc: 65% identical to dephospho-CoA kinase (Escherichia coli K-12 substr. MG1655)
Dephospho-CoA kinase. [EC: 2.7.1.24]

Predicted SEED Role

"Dephospho-CoA kinase (EC 2.7.1.24)" in subsystem Coenzyme A Biosynthesis (EC 2.7.1.24)

MetaCyc Pathways

superpathway of coenzyme A biosynthesis I (bacteria) (9/9 steps found)
superpathway of coenzyme A biosynthesis III (mammals) (5/5 steps found)
coenzyme A biosynthesis I (bacteria) (4/4 steps found)
coenzyme A biosynthesis II (eukaryotic) (4/4 steps found)

KEGG Metabolic Maps

Pantothenate and CoA biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (204 amino acids)

>IAI46_03505 dephospho-CoA kinase (Serratia liquefaciens MT49)
MAYIVALTGGIGSGKSTVADAFARHGVTVVDADVIARQVVEPGTPALAAIAERFGNEMLQ
PDGSLNRAALRQCIFSNPDEKRWLNQLLHPLIHQETQRQLAQVTSPYALWVVPLLVENSL
QARADRVLVVDVDSETQLARTIARDGISRQQAQNILSAQVTREQRLAAADDIIDNSGTAQ
GIEPLVAALHCRYLELAASATRQD