Protein Info for IAI46_03465 in Serratia liquefaciens MT49

Annotation: cell division protein FtsZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 TIGR00065: cell division protein FtsZ" amino acids 7 to 336 (330 residues), 469.4 bits, see alignment E=4.3e-145 PF00091: Tubulin" amino acids 13 to 172 (160 residues), 173.5 bits, see alignment E=6.4e-55 PF12327: FtsZ_C" amino acids 221 to 315 (95 residues), 124.4 bits, see alignment E=1.9e-40

Best Hits

Swiss-Prot: 95% identical to FTSZ_ECO57: Cell division protein FtsZ (ftsZ) from Escherichia coli O157:H7

KEGG orthology group: K03531, cell division protein FtsZ (inferred from 100% identity to srs:SerAS12_0700)

Predicted SEED Role

"Cell division protein FtsZ (EC 3.4.24.-)" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (384 amino acids)

>IAI46_03465 cell division protein FtsZ (Serratia liquefaciens MT49)
MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTDAQALRKTAVGQTIQI
GSGITKGLGAGANPEVGRNSAEEDREALRAALDGADMVFIAAGMGGGTGTGAAPVVAEVA
KDLGILTVAVVTKPFNFEGKKRMAFAEQGIAELSKHVDSLITIPNDKLLKVLGRGISLLD
AFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGYAMMGSGVACGEDRAEEAA
EMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNTIRAFASDNATVVIGTSLDP
EMNDELRVTVVATGIGMDKRPEITLVTNKQASQPVMDHRYQQHGMSPLPQEVKPAAKVVN
DPTAQPNKEPDYLDIPAFLRKQAD