Protein Info for IAI46_03380 in Serratia liquefaciens MT49

Annotation: acetolactate synthase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00119: acetolactate synthase, small subunit
  • amino acids 1 to 159 (159 residues), 222.8 bits, E=1.1e-70
• PF01842: ACT
  • amino acids 4 to 68 (65 residues), 59.3 bits, E=3.6e-20
• PF13710: ACT_5
  • amino acids 12 to 73 (62 residues), 53.4 bits, E=2.6e-18
• PF10369: ALS_ss_C
  • amino acids 84 to 158 (75 residues), 84.9 bits, E=5.2e-28

Best Hits

Swiss-Prot: 91% identical to ILVH_SALTY: Acetolactate synthase isozyme 3 small subunit (ilvH) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01653, acetolactate synthase I/III small subunit [EC: 2.2.1.6] (inferred from 99% identity to srs:SerAS12_0683)

MetaCyc: 90% identical to acetolactate synthase / acetohydroxybutanoate synthase, regulatory subunit (Escherichia coli K-12 substr. MG1655)
Acetolactate synthase. [EC: 2.2.1.6]; 2.2.1.6 [EC: 2.2.1.6]

Predicted SEED Role

"Acetolactate synthase small subunit (EC 2.2.1.6)" in subsystem Acetoin, butanediol metabolism or Branched-Chain Amino Acid Biosynthesis (EC 2.2.1.6)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-threonine metabolism (15/18 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• L-valine biosynthesis (4/4 steps found)
• pyruvate fermentation to (S)-acetoin (3/3 steps found)
• superpathway of 2,3-butanediol biosynthesis (5/6 steps found)
• pyruvate fermentation to (R)-acetoin II (2/2 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• pyruvate fermentation to (R)-acetoin I (2/3 steps found)
• L-isoleucine biosynthesis IV (4/6 steps found)
• superpathway of (R,R)-butanediol biosynthesis (3/5 steps found)
• L-isoleucine biosynthesis III (4/7 steps found)
• L-isoleucine biosynthesis II (4/8 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Butanoate metabolism
• C5-Branched dibasic acid metabolism
• Pantothenate and CoA biosynthesis
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.6

Use Curated BLAST to search for 2.2.1.6

Protein Sequence (163 amino acids)

>IAI46_03380 acetolactate synthase small subunit (Serratia liquefaciens MT49)
MRRILSVLLENESGALSRVVGLFSQRGYNIESLTVAPTDDPTLSRMTIQTVGDEKVLEQI
EKQLHKLVDVLRVSELVQGAHVEREIMLVKLQASGYGREEVKRCADIFRGQIVDVTATLY
TVQLAGTSDKLDAFLSAVREVAEIVEVARSGVVGVSRGDKIMR