Protein Info for IAI46_03335 in Serratia liquefaciens MT49

Annotation: DASS family sodium-coupled anion symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 transmembrane" amino acids 9 to 28 (20 residues), see Phobius details amino acids 34 to 51 (18 residues), see Phobius details amino acids 57 to 74 (18 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 195 to 215 (21 residues), see Phobius details amino acids 227 to 252 (26 residues), see Phobius details amino acids 282 to 304 (23 residues), see Phobius details amino acids 311 to 329 (19 residues), see Phobius details amino acids 341 to 364 (24 residues), see Phobius details amino acids 376 to 397 (22 residues), see Phobius details amino acids 405 to 431 (27 residues), see Phobius details amino acids 439 to 458 (20 residues), see Phobius details amino acids 464 to 486 (23 residues), see Phobius details PF00939: Na_sulph_symp" amino acids 12 to 490 (479 residues), 492.6 bits, see alignment E=1.4e-151 TIGR00785: transporter, divalent anion:Na+ symporter (DASS) family" amino acids 27 to 484 (458 residues), 380.4 bits, see alignment E=5.6e-118 PF03600: CitMHS" amino acids 48 to 419 (372 residues), 79.8 bits, see alignment E=2.1e-26

Best Hits

Swiss-Prot: 51% identical to YFLS_BACSU: Putative malate transporter YflS (yflS) from Bacillus subtilis (strain 168)

KEGG orthology group: K03319, divalent anion:Na+ symporter, DASS family (inferred from 96% identity to spe:Spro_0741)

Predicted SEED Role

"2-oxoglutarate/malate translocator" in subsystem Photorespiration (oxidative C2 cycle)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (490 amino acids)

>IAI46_03335 DASS family sodium-coupled anion symporter (Serratia liquefaciens MT49)
MDKLTPLKPVPSLCAVVVALLIWFVIPVPEGVAPNAWHLLALFIGTIIAIIGKAMPIGAV
SIVAIALVAVTGVTNPGKPGAALNDALSGFSNQLIWLIGFSIMISLSLNKTGLGARIGYY
FISLFGKKTLGIAYALTLAETTLAPVTPSNTARGGGIIHPIMKSIADSFGSRPELNTSGK
IGRYLSLVNYNINPITSAMFITATAPNPLIVSLIAKGTHGNFELSWSMWAIAALVPGVCS
LIVMPLVIYLLYPPEVKSTPDAPRFARDKLQALGPVTLPEKITLAVFALLLVLWAGIPAM
IFGPALAVNPTTAALIGLAVLLATGVLSWEDVLKHKGAWDTVVWFSALVMMASFLGKLGL
ISWLSQTVGSGIDHMGMSWAGGTVLLTIIYLYSHYFFASTTAHVTAMFAAFFAAGVALGA
PPALLGLILAFSSSLMMSLTHYGTGTAPIIFGSGYVTLGEWWKAGFVMSVINLLIWMLIG
GAWWKWLGYW