Protein Info for IAI46_03330 in Serratia liquefaciens MT49

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 48 to 70 (23 residues), see Phobius details amino acids 82 to 99 (18 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details amino acids 168 to 190 (23 residues), see Phobius details amino acids 229 to 250 (22 residues), see Phobius details amino acids 263 to 284 (22 residues), see Phobius details amino acids 292 to 310 (19 residues), see Phobius details amino acids 317 to 338 (22 residues), see Phobius details amino acids 350 to 371 (22 residues), see Phobius details amino acids 378 to 396 (19 residues), see Phobius details TIGR00899: sugar efflux transporter" amino acids 17 to 399 (383 residues), 525.5 bits, see alignment E=4.1e-162 PF13347: MFS_2" amino acids 18 to 315 (298 residues), 39.1 bits, see alignment E=5.5e-14 PF07690: MFS_1" amino acids 19 to 312 (294 residues), 119.6 bits, see alignment E=2.3e-38 amino acids 229 to 394 (166 residues), 64.1 bits, see alignment E=1.7e-21 PF12832: MFS_1_like" amino acids 23 to 361 (339 residues), 43.8 bits, see alignment E=2.7e-15

Best Hits

KEGG orthology group: None (inferred from 92% identity to srr:SerAS9_0674)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (401 amino acids)

>IAI46_03330 MFS transporter (Serratia liquefaciens MT49)
MKRLHWLPRRFNPVFAAFLLIAFLSGIAGALLAPTLSLFLTTEVKVRPLWVGLFYTVNAI
VGIAVSFLLAKRSDTRGDRRKLILVCCLMAVGNCLLFAFNRDYLTLITAGVLLSAIANTA
MPQIFALAREYADSSAREVVMFSSVMRAQLSLAWVIGPPLSFTLALNYGFTVMFVIAAAT
FAICALLVWFTLPSVPRVAPVEPADTLIAAPSAPIAPVSAWRNPDVRRLFIASVLMWTCN
TMYIIDMPLYITADLGLPENLAGLLMGTAAGLEIPAMLLAGYYVKRFGKRNMMLFAVVAG
ILFYAGLVVFKFKLALMVLQLFNAIFIGIIAGIGMLYFQDLMPGRPGAATTLFTNSISTG
VILAGVLQGALVENLGHYAVYWLAALLAVAALWMSARVREV