Protein Info for IAI46_03305 in Serratia liquefaciens MT49

Annotation: thiamine ABC transporter ATP-binding protein ThiQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01277: thiamine ABC transporter, ATP-binding protein
  • amino acids 2 to 209 (208 residues), 331.5 bits, E=1.1e-103
• PF00005: ABC_tran
  • amino acids 18 to 157 (140 residues), 121.7 bits, E=3.8e-39
• PF13304: AAA_21
  • amino acids 123 to 190 (68 residues), 30.3 bits, E=4.2e-11

Best Hits

Swiss-Prot: 79% identical to THIQ_YERPS: Thiamine import ATP-binding protein ThiQ (thiQ) from Yersinia pseudotuberculosis serotype I (strain IP32953)

KEGG orthology group: None (inferred from 94% identity to srs:SerAS12_0669)

MetaCyc: 65% identical to thiamine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-32-RXN [EC: 7.6.2.15]

Predicted SEED Role

"Thiamin ABC transporter, ATPase component / Thiamine transport ATP-binding protein thiQ" in subsystem Thiamin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.15

Protein Sequence (234 amino acids)

>IAI46_03305 thiamine ABC transporter ATP-binding protein ThiQ (Serratia liquefaciens MT49)
MLKLEKLTYLYEHLPMRFDLRIQPGERVAVLGPSGAGKSTLLSLIAGFLPSASGRLLLNG
SDHTGTPPAKRPVSMLFQENNLFAHLTVAQNIGLGLDPGLRLNEEQKRQLAQIARQVGLE
EHLPRLPSQLSGGQRQRAALARCLIRQRPILLLDEPFSALDPALRNEMLQLLQEVCDQRN
LTLSMVSHNLDDAARIAPRTLLVVDGRIFYDGPTQALLDGSAPEAKVLGISHKP